Placeholder image of a protein
Icon representing a puzzle

1276: Revisiting Puzzle 68: Bos Taurus

Closed since almost 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 23, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,459
  2. Avatar for Contenders 2. Contenders 70 pts. 9,450
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,445
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 9,424
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 9,424
  6. Avatar for Go Science 6. Go Science 11 pts. 9,388
  7. Avatar for HMT heritage 7. HMT heritage 7 pts. 9,361
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,339
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 2 pts. 9,220
  10. Avatar for It's over 9000! 10. It's over 9000! 1 pt. 8,910

  1. Avatar for eromana 81. eromana Lv 1 4 pts. 9,064
  2. Avatar for MicElephant 82. MicElephant Lv 1 4 pts. 9,049
  3. Avatar for Marvelz 83. Marvelz Lv 1 4 pts. 9,041
  4. Avatar for dbuske 84. dbuske Lv 1 3 pts. 9,039
  5. Avatar for gurch 85. gurch Lv 1 3 pts. 9,033
  6. Avatar for fishercat 86. fishercat Lv 1 3 pts. 9,018
  7. Avatar for SouperGenious 87. SouperGenious Lv 1 3 pts. 9,006
  8. Avatar for pizpot 88. pizpot Lv 1 3 pts. 8,983
  9. Avatar for deLaCeiba 89. deLaCeiba Lv 1 3 pts. 8,968
  10. Avatar for JUMELLE54 90. JUMELLE54 Lv 1 2 pts. 8,962

Comments