Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Contenders 100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891

  1. Avatar for leehaggis 121. leehaggis Lv 1 1 pt. 8,072
  2. Avatar for tscherulli 122. tscherulli Lv 1 1 pt. 8,059
  3. Avatar for Jim Fraser 123. Jim Fraser Lv 1 1 pt. 8,053
  4. Avatar for Cerzax 124. Cerzax Lv 1 1 pt. 8,036
  5. Avatar for Threeoak 125. Threeoak Lv 1 1 pt. 8,008
  6. Avatar for Superphosphate 126. Superphosphate Lv 1 1 pt. 7,986
  7. Avatar for stephen.r.lewis86 127. stephen.r.lewis86 Lv 1 1 pt. 7,978
  8. Avatar for momadoc 128. momadoc Lv 1 1 pt. 7,967
  9. Avatar for Ariasmpony 129. Ariasmpony Lv 1 1 pt. 7,941
  10. Avatar for byewelt 130. byewelt Lv 1 1 pt. 7,936

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN