It is known that in computer science there is no absolute randomness, and all data is predictable. There is also a grain of randomness. What if the grain is protein? There is also a data visualization site that claims that it is impossible to predict the outcome of a random image.
http://www.random-art.org/online/
I am not a bio computer scientist, but I would be interested to know how the proteins differ in which beautiful images are drawn from ugly images
TNEWKHKLKDMDCPWAYCETGEWEHRHFFPWSVIREIRVRYNKSVCCEDYFIDPYARGDN
RVATVHIQSWWDADWQIHGM
I found a protein with 80 amino acid residues. Which draws such a picture. such images are only 5%. The remaining 95% is pixel chaos
For example, this amino acid sequence
FTPDEIEMKLRNCDSLIWVNKGGPNFLHYVAHQHCPAWQIDEYDSEEPQKAHMMNHVTQE
DVRCQWKQHKFANGCDVFDY
For example, this protein draws a solid image.
HRYLPHCKMHGQTKIFWNWRCMYYFHMIGTAECNVFQCYFCVWCSSYWEHATSPKRLGQW VELCDREHWHTTLNWDTPGY
For example, this protein draws fractal patterns.
TWMMLDTCLQPVQHLGLPWALAHIPSYCTIRQIIKANCSYYFGCALPLVTQTPINMRMQS AIGADYSKNSTTVTHTIWEK
Data from this protein shows circular structuredness. If you could find interesting structures by teaching a neural network. Or how to get knowledge of how it affects protein.
FRMMHDKCKYIFQHQSQWCPFEDNGSYWMSGTKSKHRGKIAMPHEYSWTISRTCLCIFIV CKEKAHRVIDRWMWMRGWKA
Information from this section can be freely copied and distributed. Everything for open science!
See what an interesting pattern!
Here is the protein sequence. And if we delete 1 character each and press enter, then always the colors or most of them will be solid colors.
QREVHIPYNVTDVKEMGGADNGFWCMYYPHGSQKQERDGELEGIPQVRPNEIIRSKPHLW
TELLTTDTPTYPGADVHFNQRIDCDKKPNWWAAEAIDLRRVNLLEREYQSYRYPFQQTEK
EGVKPYSCYVRWKDPYAYPYNEWM
That is, it is a protein of solid colors.
interesting discovery
I agree. Having the website painting generation program output solid colors, when 1 character is deleted each, sounds truly fascinating to me. This phenomenon can help us determine how the random art website works, and how it makes its paintings.
Also, I have a hypothesis for the second word in a picture's name.
If that word ends with a vowel, then the resulting painting is likely to be more tessellated and tapestry-like and having a repetitive design.
This is because in the "About" tab, the Demo Red and Demo Green do not have repetitive tessellated design because "Red" and "Green" end in consonants, not vowels. But since "Blue" ends with a vowel, the letter "e", the painting "Demo Blue" has a repetitive and tessellated design.
I wonder what do you think of my hypothesis? I think it is something good to be tested as a sort-of "sub-experiment".
Hi everyone! Due to continued spam on this post, we will be disabling comments for this thread. If you would like to continue this conversation, I would suggest creating a new thread. Thank you for your understanding.
