Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since almost 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,501
  2. Avatar for SETI.Germany 12. SETI.Germany 6 pts. 8,417
  3. Avatar for freefolder 13. freefolder 4 pts. 8,343
  4. Avatar for Natural Abilities 14. Natural Abilities 3 pts. 7,989
  5. Avatar for Herobrine's Army 15. Herobrine's Army 2 pts. 7,973
  6. Avatar for HMT heritage 16. HMT heritage 2 pts. 7,942
  7. Avatar for Russian team 17. Russian team 1 pt. 7,520
  8. Avatar for Deleted group 18. Deleted group pts. 7,512
  9. Avatar for xkcd 19. xkcd 1 pt. 7,340
  10. Avatar for Chem233W15 20. Chem233W15 1 pt. 7,234
  1. Avatar for jobo0502 31. jobo0502 Lv 1 51 pts. 8,702
  2. Avatar for tzabaoth 32. tzabaoth Lv 1 49 pts. 8,690
  3. Avatar for nemo7731 33. nemo7731 Lv 1 48 pts. 8,650
  4. Avatar for goastano 34. goastano Lv 1 47 pts. 8,569
  5. Avatar for silverberg 35. silverberg Lv 1 46 pts. 8,567
  6. Avatar for ViJay7019 36. ViJay7019 Lv 1 45 pts. 8,565
  7. Avatar for pmdpmd 37. pmdpmd Lv 1 44 pts. 8,520
  8. Avatar for santex 38. santex Lv 1 43 pts. 8,520
  9. Avatar for uhuuhu 39. uhuuhu Lv 1 42 pts. 8,519
  10. Avatar for brow42 40. brow42 Lv 1 41 pts. 8,513

Comments

HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.