Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 8 pts. 8,501
  2. Avatar for SETI.Germany 12. SETI.Germany 6 pts. 8,417
  3. Avatar for freefolder 13. freefolder 4 pts. 8,343
  4. Avatar for Natural Abilities 14. Natural Abilities 3 pts. 7,989
  5. Avatar for Herobrine's Army 15. Herobrine's Army 2 pts. 7,973
  6. Avatar for HMT heritage 16. HMT heritage 2 pts. 7,942
  7. Avatar for Russian team 17. Russian team 1 pt. 7,520
  8. Avatar for Deleted group 18. Deleted group pts. 7,512
  9. Avatar for xkcd 19. xkcd 1 pt. 7,340
  10. Avatar for Chem233W15 20. Chem233W15 1 pt. 7,234

  1. Avatar for ncm25_OLD 51. ncm25_OLD Lv 1 30 pts. 8,300
  2. Avatar for ecali 52. ecali Lv 1 30 pts. 8,292
  3. Avatar for smilingone 53. smilingone Lv 1 29 pts. 8,290
  4. Avatar for deLaCeiba 54. deLaCeiba Lv 1 28 pts. 8,280
  5. Avatar for johnmitch 55. johnmitch Lv 1 27 pts. 8,266
  6. Avatar for gurra66 56. gurra66 Lv 1 27 pts. 8,240
  7. Avatar for gloverd 57. gloverd Lv 1 26 pts. 8,215
  8. Avatar for manu8170 58. manu8170 Lv 1 25 pts. 8,206
  9. Avatar for bx7gn 59. bx7gn Lv 1 24 pts. 8,122
  10. Avatar for Ashrai 60. Ashrai Lv 1 24 pts. 8,090

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.