Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584

  1. Avatar for andrewxc 91. andrewxc Lv 1 9 pts. 7,747
  2. Avatar for christioanchauvin 92. christioanchauvin Lv 1 9 pts. 7,745
  3. Avatar for Origami314 93. Origami314 Lv 1 9 pts. 7,738
  4. Avatar for wanjiayu 94. wanjiayu Lv 1 8 pts. 7,732
  5. Avatar for cobaltteal 95. cobaltteal Lv 1 8 pts. 7,732
  6. Avatar for navn 96. navn Lv 1 8 pts. 7,726
  7. Avatar for mirjamvandelft 97. mirjamvandelft Lv 1 8 pts. 7,707
  8. Avatar for heather-1 98. heather-1 Lv 1 7 pts. 7,707
  9. Avatar for mimi 99. mimi Lv 1 7 pts. 7,704
  10. Avatar for Iron pet 100. Iron pet Lv 1 7 pts. 7,632

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.