Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584
  1. Avatar for stuk88 161. stuk88 Lv 1 1 pt. 5,517
  2. Avatar for AleXusher 162. AleXusher Lv 1 1 pt. 5,497
  3. Avatar for rezaefar 163. rezaefar Lv 1 1 pt. 5,438
  4. Avatar for Johnrqrqrq 164. Johnrqrqrq Lv 1 1 pt. 5,308
  5. Avatar for Kronc68 165. Kronc68 Lv 1 1 pt. 5,212
  6. Avatar for NotJim99 166. NotJim99 Lv 1 1 pt. 5,180
  7. Avatar for marie.p 167. marie.p Lv 1 1 pt. 5,174
  8. Avatar for Featherstonehaugh 168. Featherstonehaugh Lv 1 1 pt. 5,082
  9. Avatar for ComputerMage 169. ComputerMage Lv 1 1 pt. 5,029
  10. Avatar for cathypham 170. cathypham Lv 1 1 pt. 5,023

Comments

HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.