Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584

  1. Avatar for elysecat 211. elysecat Lv 1 1 pt. 2,376
  2. Avatar for jermainiac 212. jermainiac Lv 1 1 pt. 2,352
  3. Avatar for gamergater 213. gamergater Lv 1 1 pt. 2,170
  4. Avatar for Marvelz 214. Marvelz Lv 1 1 pt. 2,166
  5. Avatar for asliciragan 215. asliciragan Lv 1 1 pt. 1,868
  6. Avatar for jebbiek 216. jebbiek Lv 1 1 pt. 1,755
  7. Avatar for LizLEC 217. LizLEC Lv 1 1 pt. 1,703
  8. Avatar for kitek314_pl 218. kitek314_pl Lv 1 1 pt. 584
  9. Avatar for Holyaws 219. Holyaws Lv 1 1 pt. 0
  10. Avatar for KarenCH 220. KarenCH Lv 1 1 pt. 0

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.