Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584
  1. Avatar for jobo0502 31. jobo0502 Lv 1 51 pts. 8,702
  2. Avatar for tzabaoth 32. tzabaoth Lv 1 49 pts. 8,690
  3. Avatar for nemo7731 33. nemo7731 Lv 1 48 pts. 8,650
  4. Avatar for goastano 34. goastano Lv 1 47 pts. 8,569
  5. Avatar for silverberg 35. silverberg Lv 1 46 pts. 8,567
  6. Avatar for ViJay7019 36. ViJay7019 Lv 1 45 pts. 8,565
  7. Avatar for pmdpmd 37. pmdpmd Lv 1 44 pts. 8,520
  8. Avatar for santex 38. santex Lv 1 43 pts. 8,520
  9. Avatar for uhuuhu 39. uhuuhu Lv 1 42 pts. 8,519
  10. Avatar for brow42 40. brow42 Lv 1 41 pts. 8,513

Comments

HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.