Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups

  1. Avatar for Eὕρηκα! Heureka! 21. Eὕρηκα! Heureka! 1 pt. 5,705
  2. Avatar for Team Germany 22. Team Germany 1 pt. 5,497
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 4,680
  4. Avatar for It's over 9000! 24. It's over 9000! 1 pt. 3,655
  5. Avatar for SETIKAH@KOREA 25. SETIKAH@KOREA 1 pt. 3,305
  6. Avatar for BOINC@Poland 26. BOINC@Poland 1 pt. 584
  1. Avatar for Bushman 41. Bushman Lv 1 39 pts. 8,501
  2. Avatar for Bletchley Park 42. Bletchley Park Lv 1 38 pts. 8,482
  3. Avatar for mirp 43. mirp Lv 1 38 pts. 8,464
  4. Avatar for Bautho 44. Bautho Lv 1 37 pts. 8,417
  5. Avatar for Sissue 45. Sissue Lv 1 36 pts. 8,412
  6. Avatar for dcrwheeler 46. dcrwheeler Lv 1 35 pts. 8,404
  7. Avatar for gmn 47. gmn Lv 1 34 pts. 8,367
  8. Avatar for joremen 48. joremen Lv 1 33 pts. 8,353
  9. Avatar for Altercomp 49. Altercomp Lv 1 32 pts. 8,343
  10. Avatar for Lindata 50. Lindata Lv 1 31 pts. 8,323

Comments

HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.