Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since about 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Go Science 100 pts. 9,253
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 82 pts. 9,213
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,178
  4. Avatar for Gargleblasters 4. Gargleblasters 53 pts. 9,157
  5. Avatar for Void Crushers 5. Void Crushers 42 pts. 8,955
  6. Avatar for Deleted group 6. Deleted group pts. 8,931
  7. Avatar for Contenders 7. Contenders 26 pts. 8,870
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 20 pts. 8,869
  9. Avatar for Deleted group 9. Deleted group pts. 8,760
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 11 pts. 8,565

  1. Avatar for andrewxc 91. andrewxc Lv 1 9 pts. 7,747
  2. Avatar for christioanchauvin 92. christioanchauvin Lv 1 9 pts. 7,745
  3. Avatar for Origami314 93. Origami314 Lv 1 9 pts. 7,738
  4. Avatar for wanjiayu 94. wanjiayu Lv 1 8 pts. 7,732
  5. Avatar for cobaltteal 95. cobaltteal Lv 1 8 pts. 7,732
  6. Avatar for navn 96. navn Lv 1 8 pts. 7,726
  7. Avatar for mirjamvandelft 97. mirjamvandelft Lv 1 8 pts. 7,707
  8. Avatar for heather-1 98. heather-1 Lv 1 7 pts. 7,707
  9. Avatar for mimi 99. mimi Lv 1 7 pts. 7,704
  10. Avatar for Iron pet 100. Iron pet Lv 1 7 pts. 7,632

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.