Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since almost 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,253
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 82 pts. 9,213
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,178
  4. Avatar for Gargleblasters 4. Gargleblasters 53 pts. 9,157
  5. Avatar for Void Crushers 5. Void Crushers 42 pts. 8,955
  6. Avatar for Deleted group 6. Deleted group pts. 8,931
  7. Avatar for Contenders 7. Contenders 26 pts. 8,870
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 20 pts. 8,869
  9. Avatar for Deleted group 9. Deleted group pts. 8,760
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 11 pts. 8,565
  1. Avatar for reefyrob 21. reefyrob Lv 1 64 pts. 8,864
  2. Avatar for steveB 22. steveB Lv 1 63 pts. 8,848
  3. Avatar for grogar7 23. grogar7 Lv 1 61 pts. 8,798
  4. Avatar for Glen B 24. Glen B Lv 1 60 pts. 8,792
  5. Avatar for bertro 25. bertro Lv 1 59 pts. 8,774
  6. Avatar for Museka 26. Museka Lv 1 57 pts. 8,771
  7. Avatar for eusair 27. eusair Lv 1 56 pts. 8,766
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 55 pts. 8,760
  9. Avatar for g_b 29. g_b Lv 1 53 pts. 8,751
  10. Avatar for frood66 30. frood66 Lv 1 52 pts. 8,712

Comments

HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.