Placeholder image of a protein
Icon representing a puzzle

1061: De-novo Freestyle 49: Hand-folding Round

Closed since almost 11 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
March 09, 2015
Expires
Max points
100
Description

In this de-novo freestyle puzzle, only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be reposted with LUA scripts and sharing enabled. The PSIPRED secondary structure predictions are provided on the starting model.

Top groups


  1. Avatar for Go Science 100 pts. 9,253
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 82 pts. 9,213
  3. Avatar for Beta Folders 3. Beta Folders 66 pts. 9,178
  4. Avatar for Gargleblasters 4. Gargleblasters 53 pts. 9,157
  5. Avatar for Void Crushers 5. Void Crushers 42 pts. 8,955
  6. Avatar for Deleted group 6. Deleted group pts. 8,931
  7. Avatar for Contenders 7. Contenders 26 pts. 8,870
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 20 pts. 8,869
  9. Avatar for Deleted group 9. Deleted group pts. 8,760
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 11 pts. 8,565

  1. Avatar for PrettyPony2001 71. PrettyPony2001 Lv 1 17 pts. 8,019
  2. Avatar for Mydogisa Toelicker 72. Mydogisa Toelicker Lv 1 17 pts. 8,002
  3. Avatar for cbwest 73. cbwest Lv 1 16 pts. 8,001
  4. Avatar for ManVsYard 74. ManVsYard Lv 1 16 pts. 8,001
  5. Avatar for sheerbliss 75. sheerbliss Lv 1 15 pts. 7,998
  6. Avatar for Mr_Jolty 76. Mr_Jolty Lv 1 15 pts. 7,989
  7. Avatar for HerobrinesArmy 77. HerobrinesArmy Lv 1 14 pts. 7,973
  8. Avatar for Blipperman 78. Blipperman Lv 1 14 pts. 7,961
  9. Avatar for O Seki To 79. O Seki To Lv 1 14 pts. 7,942
  10. Avatar for arginia 80. arginia Lv 1 13 pts. 7,942

Comments


HerobrinesArmy Lv 1

It's <div style="font-size: 10px">veeifasgtwhvvdfygkanwdkrngepkynamahnpdktiategrkaldiihgfnitfkadgtftgsiqngtiegtwqadgkdrtvninftktppstsynnefiealnnaifyqgdsnvlllapegkktyiqfahnkqd</div> in case anyone wants to run their own secondary structure predictions.