Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014

  1. Avatar for hada 111. hada Lv 1 7 pts. 8,506
  2. Avatar for DodoBird 112. DodoBird Lv 1 7 pts. 8,503
  3. Avatar for Mr_Jolty 113. Mr_Jolty Lv 1 7 pts. 8,502
  4. Avatar for Roukess 114. Roukess Lv 1 7 pts. 8,497
  5. Avatar for bamh 115. bamh Lv 1 6 pts. 8,493
  6. Avatar for pfirth 116. pfirth Lv 1 6 pts. 8,489
  7. Avatar for Pro Lapser 117. Pro Lapser Lv 1 6 pts. 8,484
  8. Avatar for Ernst Zundel 118. Ernst Zundel Lv 1 6 pts. 8,483
  9. Avatar for ViJay7019 119. ViJay7019 Lv 1 6 pts. 8,478
  10. Avatar for Festering Wounds 120. Festering Wounds Lv 1 5 pts. 8,475

Comments