Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014
  1. Avatar for Timo van der Laan 11. Timo van der Laan Lv 1 83 pts. 8,985
  2. Avatar for frood66 12. frood66 Lv 1 81 pts. 8,983
  3. Avatar for pauldunn 13. pauldunn Lv 1 80 pts. 8,975
  4. Avatar for hpaege 14. hpaege Lv 1 78 pts. 8,975
  5. Avatar for Aubade01 15. Aubade01 Lv 1 77 pts. 8,967
  6. Avatar for aznarog 16. aznarog Lv 1 75 pts. 8,960
  7. Avatar for YeshuaLives 17. YeshuaLives Lv 1 74 pts. 8,956
  8. Avatar for zeroblue 18. zeroblue Lv 1 72 pts. 8,948
  9. Avatar for Galaxie 19. Galaxie Lv 1 71 pts. 8,945
  10. Avatar for Blipperman 20. Blipperman Lv 1 69 pts. 8,933

Comments