Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014
  1. Avatar for JBrizzle 201. JBrizzle Lv 1 1 pt. 7,849
  2. Avatar for Ronndog 202. Ronndog Lv 1 1 pt. 7,837
  3. Avatar for lamoille 203. lamoille Lv 1 1 pt. 7,829
  4. Avatar for Duke_K 204. Duke_K Lv 1 1 pt. 7,818
  5. Avatar for Aldrovanda 205. Aldrovanda Lv 1 1 pt. 7,815
  6. Avatar for redguy 206. redguy Lv 1 1 pt. 7,811
  7. Avatar for bonorway 207. bonorway Lv 1 1 pt. 7,806
  8. Avatar for Gloreh 208. Gloreh Lv 1 1 pt. 7,805
  9. Avatar for Doveda 209. Doveda Lv 1 1 pt. 7,803
  10. Avatar for FreeFolder 210. FreeFolder Lv 1 1 pt. 7,790

Comments