Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014
  1. Avatar for Ling Ying 211. Ling Ying Lv 1 1 pt. 7,790
  2. Avatar for stanlee2 212. stanlee2 Lv 1 1 pt. 7,777
  3. Avatar for Cato2K18 213. Cato2K18 Lv 1 1 pt. 7,771
  4. Avatar for Gnare 214. Gnare Lv 1 1 pt. 7,770
  5. Avatar for coupventdesgraviers 215. coupventdesgraviers Lv 1 1 pt. 7,769
  6. Avatar for timj312 216. timj312 Lv 1 1 pt. 7,743
  7. Avatar for Satina 217. Satina Lv 1 1 pt. 7,731
  8. Avatar for Raimo 218. Raimo Lv 1 1 pt. 7,729
  9. Avatar for GreekCivilization 219. GreekCivilization Lv 1 1 pt. 7,722
  10. Avatar for trentis1 220. trentis1 Lv 1 1 pt. 7,713

Comments