Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014
  1. Avatar for annwro 231. annwro Lv 1 1 pt. 7,531
  2. Avatar for cnhrcolemam 232. cnhrcolemam Lv 1 1 pt. 7,520
  3. Avatar for Trevis41 233. Trevis41 Lv 1 1 pt. 7,515
  4. Avatar for LuminousCarp 234. LuminousCarp Lv 1 1 pt. 7,403
  5. Avatar for alanrichard 235. alanrichard Lv 1 1 pt. 7,399
  6. Avatar for t012 236. t012 Lv 1 1 pt. 7,371
  7. Avatar for smarthuman 237. smarthuman Lv 1 1 pt. 7,338
  8. Avatar for Hansie 238. Hansie Lv 1 1 pt. 7,331
  9. Avatar for Sydefecks 239. Sydefecks Lv 1 1 pt. 7,329
  10. Avatar for JBitD 240. JBitD Lv 1 1 pt. 7,312

Comments