Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014

  1. Avatar for gurra66 21. gurra66 Lv 1 68 pts. 8,929
  2. Avatar for mirp 22. mirp Lv 1 66 pts. 8,928
  3. Avatar for actiasluna 23. actiasluna Lv 1 65 pts. 8,927
  4. Avatar for gurch 24. gurch Lv 1 64 pts. 8,922
  5. Avatar for rjsthethird 25. rjsthethird Lv 1 62 pts. 8,920
  6. Avatar for mimi 26. mimi Lv 1 61 pts. 8,907
  7. Avatar for egran48 27. egran48 Lv 1 60 pts. 8,904
  8. Avatar for joremen 28. joremen Lv 1 59 pts. 8,884
  9. Avatar for grogar7 29. grogar7 Lv 1 57 pts. 8,870
  10. Avatar for ZeroLeak7 30. ZeroLeak7 Lv 1 56 pts. 8,864

Comments