Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Russian team 11. Russian team 4 pts. 8,670
  2. Avatar for Deleted group 12. Deleted group pts. 8,628
  3. Avatar for xkcd 13. xkcd 2 pts. 8,623
  4. Avatar for Natural Abilities 14. Natural Abilities 1 pt. 8,502
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,478
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 8,435
  7. Avatar for It's over 9000! 17. It's over 9000! 1 pt. 8,398
  8. Avatar for freefolder 18. freefolder 1 pt. 8,397
  9. Avatar for Dnice.dk 19. Dnice.dk 1 pt. 8,367
  10. Avatar for CureCoin 20. CureCoin 1 pt. 8,014
  1. Avatar for andrewxc 41. andrewxc Lv 1 44 pts. 8,833
  2. Avatar for gitwut 42. gitwut Lv 1 43 pts. 8,832
  3. Avatar for dcrwheeler 43. dcrwheeler Lv 1 42 pts. 8,831
  4. Avatar for johnmitch 44. johnmitch Lv 1 41 pts. 8,829
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 41 pts. 8,827
  6. Avatar for gloverd 46. gloverd Lv 1 40 pts. 8,827
  7. Avatar for decbin 47. decbin Lv 1 39 pts. 8,826
  8. Avatar for martin.szew 48. martin.szew Lv 1 38 pts. 8,826
  9. Avatar for Sissue 49. Sissue Lv 1 37 pts. 8,823
  10. Avatar for spmm 50. spmm Lv 1 36 pts. 8,819

Comments