1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Summary

• Created: July 06, 2015
• Expires: July 14, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 21. DSN @ Home 1 pt. 7,006

Top soloists

• 1. LociOiling 100 pts. 9,083
• 2. KarenCH 99 pts. 9,069
• 3. Deleted player pts. 9,047
• 4. dembones 95 pts. 9,042
• 5. retiredmichael 93 pts. 9,040
• 6. Bruno Kestemont 91 pts. 9,030
• 7. viosca 90 pts. 9,013
• 8. bertro 88 pts. 9,011
• 9. sheerbliss 86 pts. 8,999
• 10. g_b 85 pts. 8,993