1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Summary

• Created: July 06, 2015
• Expires: July 14, 2015 at 11:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

• 21. DSN @ Home 1 pt. 7,006

Top evolvers

• 1. smilingone 100 pts. 9,094
• 2. LociOiling 89 pts. 9,092
• 3. Deleted player pts. 9,091
• 4. Galaxie 68 pts. 9,066
• 5. reefyrob 60 pts. 9,065
• 6. MaartenDesnouck 52 pts. 9,061
• 7. Deleted player 45 pts. 9,060
• 8. brgreening 39 pts. 9,055
• 9. bertro 33 pts. 9,055
• 10. retiredmichael 28 pts. 9,047