Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 24 pts. 9,045
  2. Avatar for jamiexq 12. jamiexq Lv 1 21 pts. 9,040
  3. Avatar for Lindata 13. Lindata Lv 1 17 pts. 9,040
  4. Avatar for alwen 14. alwen Lv 1 15 pts. 9,040
  5. Avatar for lamoille 15. lamoille Lv 1 12 pts. 9,040
  6. Avatar for Paulo Roque 16. Paulo Roque Lv 1 10 pts. 9,028
  7. Avatar for mirp 17. mirp Lv 1 8 pts. 9,028
  8. Avatar for egran48 18. egran48 Lv 1 7 pts. 9,028
  9. Avatar for gloverd 19. gloverd Lv 1 6 pts. 9,027
  10. Avatar for packer 20. packer Lv 1 4 pts. 9,026

Comments