Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809

  1. Avatar for froggs554 131. froggs554 Lv 1 4 pts. 8,436
  2. Avatar for gldisater 132. gldisater Lv 1 4 pts. 8,435
  3. Avatar for Tweedle Dumb 133. Tweedle Dumb Lv 1 4 pts. 8,435
  4. Avatar for TJOK fan 134. TJOK fan Lv 1 3 pts. 8,433
  5. Avatar for smholst 135. smholst Lv 1 3 pts. 8,433
  6. Avatar for abiogenesis 136. abiogenesis Lv 1 3 pts. 8,431
  7. Avatar for CerebralEcstasy 137. CerebralEcstasy Lv 1 3 pts. 8,430
  8. Avatar for rinze 138. rinze Lv 1 3 pts. 8,428
  9. Avatar for martinf 139. martinf Lv 1 3 pts. 8,426
  10. Avatar for Mohambone 140. Mohambone Lv 1 3 pts. 8,425

Comments