Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 11 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809

  1. Avatar for andrewxc 41. andrewxc Lv 1 44 pts. 8,833
  2. Avatar for gitwut 42. gitwut Lv 1 43 pts. 8,832
  3. Avatar for dcrwheeler 43. dcrwheeler Lv 1 42 pts. 8,831
  4. Avatar for johnmitch 44. johnmitch Lv 1 41 pts. 8,829
  5. Avatar for hansvandenhof 45. hansvandenhof Lv 1 41 pts. 8,827
  6. Avatar for gloverd 46. gloverd Lv 1 40 pts. 8,827
  7. Avatar for decbin 47. decbin Lv 1 39 pts. 8,826
  8. Avatar for martin.szew 48. martin.szew Lv 1 38 pts. 8,826
  9. Avatar for Sissue 49. Sissue Lv 1 37 pts. 8,823
  10. Avatar for spmm 50. spmm Lv 1 36 pts. 8,819

Comments