Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since almost 11 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809

  1. Avatar for sharondipity 61. sharondipity Lv 1 28 pts. 8,724
  2. Avatar for jamiexq 62. jamiexq Lv 1 27 pts. 8,724
  3. Avatar for christioanchauvin 63. christioanchauvin Lv 1 27 pts. 8,721
  4. Avatar for Deleted player 64. Deleted player pts. 8,719
  5. Avatar for shettler 65. shettler Lv 1 25 pts. 8,718
  6. Avatar for Museka 66. Museka Lv 1 25 pts. 8,704
  7. Avatar for Skippysk8s 67. Skippysk8s Lv 1 24 pts. 8,703
  8. Avatar for Bletchley Park 68. Bletchley Park Lv 1 23 pts. 8,693
  9. Avatar for Deleted player 69. Deleted player 23 pts. 8,693
  10. Avatar for caglar 70. caglar Lv 1 22 pts. 8,682

Comments