Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Beta Folders 100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809

  1. Avatar for HJCW 161. HJCW Lv 1 1 pt. 8,316
  2. Avatar for yiminjune 162. yiminjune Lv 1 1 pt. 8,311
  3. Avatar for lacie 163. lacie Lv 1 1 pt. 8,301
  4. Avatar for mirjamvandelft 164. mirjamvandelft Lv 1 1 pt. 8,271
  5. Avatar for AryehK 165. AryehK Lv 1 1 pt. 8,266
  6. Avatar for SpikRMX 166. SpikRMX Lv 1 1 pt. 8,218
  7. Avatar for Rapture1997 167. Rapture1997 Lv 1 1 pt. 8,204
  8. Avatar for Andi1960 168. Andi1960 Lv 1 1 pt. 8,190
  9. Avatar for WBarme1234 169. WBarme1234 Lv 1 1 pt. 8,177
  10. Avatar for Jajaboman 170. Jajaboman Lv 1 1 pt. 8,164

Comments