Placeholder image of a protein
Icon representing a puzzle

1110: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,094
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 9,069
  3. Avatar for Contenders 3. Contenders 60 pts. 9,045
  4. Avatar for Go Science 4. Go Science 45 pts. 9,030
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,994
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,985
  7. Avatar for HMT heritage 7. HMT heritage 17 pts. 8,863
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 8,838
  9. Avatar for Deleted group 9. Deleted group pts. 8,823
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,809
  1. Avatar for alwen 51. alwen Lv 1 35 pts. 8,819
  2. Avatar for deLaCeiba 52. deLaCeiba Lv 1 35 pts. 8,809
  3. Avatar for jobo0502 53. jobo0502 Lv 1 34 pts. 8,800
  4. Avatar for smilingone 54. smilingone Lv 1 33 pts. 8,794
  5. Avatar for goastano 55. goastano Lv 1 32 pts. 8,792
  6. Avatar for Threeoak 56. Threeoak Lv 1 31 pts. 8,779
  7. Avatar for pvc78 57. pvc78 Lv 1 31 pts. 8,768
  8. Avatar for uhuuhu 58. uhuuhu Lv 1 30 pts. 8,767
  9. Avatar for Deleted player 59. Deleted player 29 pts. 8,759
  10. Avatar for pfeiffelfloyd 60. pfeiffelfloyd Lv 1 29 pts. 8,746

Comments