Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Russian team 11. Russian team 5 pts. 8,568
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,515
  3. Avatar for Deleted group 13. Deleted group pts. 8,461
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,385
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 8,209
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,144
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,979
  8. Avatar for xkcd 18. xkcd 1 pt. 7,795
  9. Avatar for CureCoin 19. CureCoin 1 pt. 7,427
  10. Avatar for freefolder 20. freefolder 1 pt. 7,386
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,155
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 91 pts. 9,154
  3. Avatar for jamiexq 3. jamiexq Lv 1 81 pts. 9,150
  4. Avatar for lamoille 4. lamoille Lv 1 73 pts. 9,150
  5. Avatar for LociOiling 5. LociOiling Lv 1 65 pts. 9,140
  6. Avatar for reefyrob 6. reefyrob Lv 1 58 pts. 9,137
  7. Avatar for Deleted player 7. Deleted player pts. 9,137
  8. Avatar for smilingone 8. smilingone Lv 1 46 pts. 9,137
  9. Avatar for Deleted player 9. Deleted player 41 pts. 9,136
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 36 pts. 9,133

Comments