Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Russian team 11. Russian team 5 pts. 8,568
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,515
  3. Avatar for Deleted group 13. Deleted group pts. 8,461
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,385
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,144
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 7,979
  7. Avatar for xkcd 18. xkcd 1 pt. 7,795
  8. Avatar for CureCoin 19. CureCoin 1 pt. 7,427
  9. Avatar for freefolder 20. freefolder 1 pt. 7,386

  1. Avatar for Colostomy EXPLOSION. 111. Colostomy EXPLOSION. Lv 1 8 pts. 8,338
  2. Avatar for SKSbell 112. SKSbell Lv 1 8 pts. 8,310
  3. Avatar for DodoBird 113. DodoBird Lv 1 8 pts. 8,310
  4. Avatar for arginia 114. arginia Lv 1 8 pts. 8,297
  5. Avatar for froggs554 115. froggs554 Lv 1 8 pts. 8,254
  6. Avatar for PrettyPony2001 116. PrettyPony2001 Lv 1 7 pts. 8,247
  7. Avatar for hada 117. hada Lv 1 7 pts. 8,239
  8. Avatar for proteansoup 118. proteansoup Lv 1 7 pts. 8,235
  9. Avatar for rinze 119. rinze Lv 1 7 pts. 8,226
  10. Avatar for sharondipity 120. sharondipity Lv 1 7 pts. 8,215

Comments