Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,155
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 91 pts. 9,154
  3. Avatar for jamiexq 3. jamiexq Lv 1 81 pts. 9,150
  4. Avatar for lamoille 4. lamoille Lv 1 73 pts. 9,150
  5. Avatar for LociOiling 5. LociOiling Lv 1 65 pts. 9,140
  6. Avatar for reefyrob 6. reefyrob Lv 1 58 pts. 9,137
  7. Avatar for Deleted player 7. Deleted player pts. 9,137
  8. Avatar for smilingone 8. smilingone Lv 1 46 pts. 9,137
  9. Avatar for Deleted player 9. Deleted player 41 pts. 9,136
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 36 pts. 9,133

Comments