Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Overall Overall Overall Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Vredeman
    1. Vredeman Lv 1
    100 pts. 9,150
  2. Avatar for spvincent 2. spvincent Lv 1 99 pts. 9,132
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 97 pts. 9,125
  4. Avatar for Madde 4. Madde Lv 1 95 pts. 9,112
  5. Avatar for MurloW 5. MurloW Lv 1 93 pts. 9,091
  6. Avatar for bertro 6. bertro Lv 1 92 pts. 9,078
  7. Avatar for dembones 7. dembones Lv 1 90 pts. 9,053
  8. Avatar for g_b 8. g_b Lv 1 88 pts. 9,043
  9. Avatar for frood66 9. frood66 Lv 1 87 pts. 9,030
  10. Avatar for gitwut 10. gitwut Lv 1 85 pts. 9,023

Comments