Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Colostomy EXPLOSION. 111. Colostomy EXPLOSION. Lv 1 8 pts. 8,338
  2. Avatar for SKSbell 112. SKSbell Lv 1 8 pts. 8,310
  3. Avatar for DodoBird 113. DodoBird Lv 1 8 pts. 8,310
  4. Avatar for arginia 114. arginia Lv 1 8 pts. 8,297
  5. Avatar for froggs554 115. froggs554 Lv 1 8 pts. 8,254
  6. Avatar for PrettyPony2001 116. PrettyPony2001 Lv 1 7 pts. 8,247
  7. Avatar for hada 117. hada Lv 1 7 pts. 8,239
  8. Avatar for proteansoup 118. proteansoup Lv 1 7 pts. 8,235
  9. Avatar for rinze 119. rinze Lv 1 7 pts. 8,226
  10. Avatar for sharondipity 120. sharondipity Lv 1 7 pts. 8,215

Comments