Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for versat82 121. versat82 Lv 1 6 pts. 8,209
  2. Avatar for trentis1 122. trentis1 Lv 1 6 pts. 8,170
  3. Avatar for joaniegirl 123. joaniegirl Lv 1 6 pts. 8,169
  4. Avatar for Mohambone 124. Mohambone Lv 1 6 pts. 8,169
  5. Avatar for TJOK fan 125. TJOK fan Lv 1 6 pts. 8,163
  6. Avatar for Andi1960 126. Andi1960 Lv 1 5 pts. 8,161
  7. Avatar for ViJay7019 127. ViJay7019 Lv 1 5 pts. 8,144
  8. Avatar for SouperGenious 128. SouperGenious Lv 1 5 pts. 8,143
  9. Avatar for Hansie 129. Hansie Lv 1 5 pts. 8,138
  10. Avatar for Satina 130. Satina Lv 1 5 pts. 8,134

Comments