Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for pmthomson90 131. pmthomson90 Lv 1 5 pts. 8,119
  2. Avatar for Merf 132. Merf Lv 1 5 pts. 8,096
  3. Avatar for 01010011111 133. 01010011111 Lv 1 4 pts. 8,070
  4. Avatar for Ernst Zundel 134. Ernst Zundel Lv 1 4 pts. 8,062
  5. Avatar for redguy 135. redguy Lv 1 4 pts. 8,051
  6. Avatar for dbuske 136. dbuske Lv 1 4 pts. 8,048
  7. Avatar for dettingen 137. dettingen Lv 1 4 pts. 8,034
  8. Avatar for Rapture1997 138. Rapture1997 Lv 1 4 pts. 8,004
  9. Avatar for martinf 139. martinf Lv 1 4 pts. 7,992
  10. Avatar for Savas 140. Savas Lv 1 4 pts. 7,979

Comments