Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0
  1. Avatar for mirjamvandelft 141. mirjamvandelft Lv 1 3 pts. 7,978
  2. Avatar for Ellis Shih 142. Ellis Shih Lv 1 3 pts. 7,946
  3. Avatar for kuuichi09 143. kuuichi09 Lv 1 3 pts. 7,942
  4. Avatar for poiuyqwert 144. poiuyqwert Lv 1 3 pts. 7,941
  5. Avatar for Paulo Roque 145. Paulo Roque Lv 1 3 pts. 7,927
  6. Avatar for smholst 146. smholst Lv 1 3 pts. 7,922
  7. Avatar for tela 147. tela Lv 1 3 pts. 7,921
  8. Avatar for lacie 148. lacie Lv 1 3 pts. 7,892
  9. Avatar for FishKAA 149. FishKAA Lv 1 3 pts. 7,812
  10. Avatar for Arne Heessels 150. Arne Heessels Lv 1 3 pts. 7,802

Comments