Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for fryguy 151. fryguy Lv 1 3 pts. 7,795
  2. Avatar for student01 152. student01 Lv 1 2 pts. 7,779
  3. Avatar for Deleted player 153. Deleted player pts. 7,771
  4. Avatar for landfrda 154. landfrda Lv 1 2 pts. 7,746
  5. Avatar for pyrogenic 155. pyrogenic Lv 1 2 pts. 7,710
  6. Avatar for Duke_K 156. Duke_K Lv 1 2 pts. 7,708
  7. Avatar for toni1223 157. toni1223 Lv 1 2 pts. 7,705
  8. Avatar for wosser1 158. wosser1 Lv 1 2 pts. 7,703
  9. Avatar for Lindata 159. Lindata Lv 1 2 pts. 7,691
  10. Avatar for NotJim99 160. NotJim99 Lv 1 2 pts. 7,681

Comments