Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0
  1. Avatar for abiogenesis 161. abiogenesis Lv 1 2 pts. 7,674
  2. Avatar for CerebralEcstasy 162. CerebralEcstasy Lv 1 2 pts. 7,664
  3. Avatar for boondog 163. boondog Lv 1 2 pts. 7,662
  4. Avatar for taminnugget 164. taminnugget Lv 1 2 pts. 7,646
  5. Avatar for armaholik 165. armaholik Lv 1 2 pts. 7,645
  6. Avatar for seigisusui 166. seigisusui Lv 1 2 pts. 7,619
  7. Avatar for aminaman 167. aminaman Lv 1 2 pts. 7,610
  8. Avatar for Tonet 168. Tonet Lv 1 1 pt. 7,606
  9. Avatar for SpikRMX 169. SpikRMX Lv 1 1 pt. 7,588
  10. Avatar for wanjiayu 170. wanjiayu Lv 1 1 pt. 7,577

Comments