Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for cnhrcolemam 171. cnhrcolemam Lv 1 1 pt. 7,561
  2. Avatar for AryehK 172. AryehK Lv 1 1 pt. 7,554
  3. Avatar for lamoille 173. lamoille Lv 1 1 pt. 7,507
  4. Avatar for Inkedhands 174. Inkedhands Lv 1 1 pt. 7,493
  5. Avatar for marcus123 175. marcus123 Lv 1 1 pt. 7,490
  6. Avatar for amiro112233 176. amiro112233 Lv 1 1 pt. 7,466
  7. Avatar for BigMatt127 177. BigMatt127 Lv 1 1 pt. 7,454
  8. Avatar for FreeFolder 178. FreeFolder Lv 1 1 pt. 7,441
  9. Avatar for wilding2004 179. wilding2004 Lv 1 1 pt. 7,427
  10. Avatar for jdmclure 180. jdmclure Lv 1 1 pt. 7,421

Comments