Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Altercomp 181. Altercomp Lv 1 1 pt. 7,386
  2. Avatar for bwkittitas 182. bwkittitas Lv 1 1 pt. 7,383
  3. Avatar for guju 183. guju Lv 1 1 pt. 7,350
  4. Avatar for hksig 184. hksig Lv 1 1 pt. 7,338
  5. Avatar for brgreening 185. brgreening Lv 1 1 pt. 7,326
  6. Avatar for lange 186. lange Lv 1 1 pt. 7,303
  7. Avatar for pfirth 187. pfirth Lv 1 1 pt. 7,298
  8. Avatar for Needo 189. Needo Lv 1 1 pt. 7,273
  9. Avatar for Luckyshot 190. Luckyshot Lv 1 1 pt. 7,258

Comments