Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 84 pts. 9,006
  2. Avatar for gloverd 12. gloverd Lv 1 82 pts. 9,003
  3. Avatar for viosca 13. viosca Lv 1 81 pts. 9,003
  4. Avatar for Galaxie 14. Galaxie Lv 1 79 pts. 8,993
  5. Avatar for mirp 15. mirp Lv 1 78 pts. 8,977
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 76 pts. 8,973
  7. Avatar for Deleted player 17. Deleted player pts. 8,972
  8. Avatar for BitSpawn 18. BitSpawn Lv 1 73 pts. 8,963
  9. Avatar for ponderosa 19. ponderosa Lv 1 72 pts. 8,943
  10. Avatar for Susume 20. Susume Lv 1 71 pts. 8,941

Comments