Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for emdee314 191. emdee314 Lv 1 1 pt. 7,243
  2. Avatar for Helmke 192. Helmke Lv 1 1 pt. 7,234
  3. Avatar for Alonso L. 193. Alonso L. Lv 1 1 pt. 7,215
  4. Avatar for pandabearsecond 194. pandabearsecond Lv 1 1 pt. 7,190
  5. Avatar for TheBrotaku 195. TheBrotaku Lv 1 1 pt. 7,174
  6. Avatar for SuperBEEP 196. SuperBEEP Lv 1 1 pt. 7,157
  7. Avatar for romanus 197. romanus Lv 1 1 pt. 7,149
  8. Avatar for biochemboi 198. biochemboi Lv 1 1 pt. 7,146
  9. Avatar for otong1 199. otong1 Lv 1 1 pt. 7,087
  10. Avatar for Deleted player 200. Deleted player 1 pt. 7,047

Comments