Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for DScott 211. DScott Lv 1 1 pt. 6,734
  2. Avatar for momadoc 212. momadoc Lv 1 1 pt. 6,726
  3. Avatar for teykaheng 213. teykaheng Lv 1 1 pt. 6,686
  4. Avatar for HJCW 214. HJCW Lv 1 1 pt. 6,654
  5. Avatar for DLXX 215. DLXX Lv 1 1 pt. 6,552
  6. Avatar for Jonask8er88 216. Jonask8er88 Lv 1 1 pt. 6,547
  7. Avatar for perrystaff 217. perrystaff Lv 1 1 pt. 6,463
  8. Avatar for quantropy 218. quantropy Lv 1 1 pt. 6,418
  9. Avatar for dpan 219. dpan Lv 1 1 pt. 6,366
  10. Avatar for griff717 220. griff717 Lv 1 1 pt. 6,331

Comments