Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0

  1. Avatar for Opus22 231. Opus22 Lv 1 1 pt. 5,547
  2. Avatar for rezaefar 232. rezaefar Lv 1 1 pt. 5,497
  3. Avatar for IgorS 233. IgorS Lv 1 1 pt. 5,484
  4. Avatar for smarthuman 234. smarthuman Lv 1 1 pt. 5,464
  5. Avatar for Ling Ying 235. Ling Ying Lv 1 1 pt. 5,454
  6. Avatar for SuperSquirrel51 236. SuperSquirrel51 Lv 1 1 pt. 5,454
  7. Avatar for PhlyingTurtle 237. PhlyingTurtle Lv 1 1 pt. 5,437
  8. Avatar for vab614 238. vab614 Lv 1 1 pt. 5,437
  9. Avatar for joublot76 239. joublot76 Lv 1 1 pt. 5,361
  10. Avatar for GenVeers 240. GenVeers Lv 1 1 pt. 5,319

Comments