Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0
  1. Avatar for meatexplosion 261. meatexplosion Lv 1 1 pt. 0
  2. Avatar for Densond 262. Densond Lv 1 1 pt. 0
  3. Avatar for fudamonsta 263. fudamonsta Lv 1 1 pt. 0
  4. Avatar for stanlee2 264. stanlee2 Lv 1 1 pt. 0
  5. Avatar for ENRA 265. ENRA Lv 1 1 pt. 0
  6. Avatar for greepski 266. greepski Lv 1 1 pt. 0
  7. Avatar for packer 267. packer Lv 1 1 pt. 0
  8. Avatar for puxatudo 268. puxatudo Lv 1 1 pt. 0
  9. Avatar for sheerbliss 269. sheerbliss Lv 1 1 pt. 0
  10. Avatar for leehaggis 270. leehaggis Lv 1 1 pt. 0

Comments