Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0
  1. Avatar for actiasluna 31. actiasluna Lv 1 57 pts. 8,848
  2. Avatar for cbwest 32. cbwest Lv 1 56 pts. 8,847
  3. Avatar for lilovip 33. lilovip Lv 1 55 pts. 8,838
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 54 pts. 8,837
  5. Avatar for johnmitch 35. johnmitch Lv 1 52 pts. 8,837
  6. Avatar for LociOiling 36. LociOiling Lv 1 51 pts. 8,829
  7. Avatar for Bletchley Park 37. Bletchley Park Lv 1 50 pts. 8,829
  8. Avatar for Museka 38. Museka Lv 1 49 pts. 8,819
  9. Avatar for Blipperman 39. Blipperman Lv 1 48 pts. 8,817
  10. Avatar for hansvandenhof 40. hansvandenhof Lv 1 47 pts. 8,803

Comments