Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Androids 21. Androids 1 pt. 7,234
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 5,220
  3. Avatar for It's over 9000! 23. It's over 9000! 1 pt. 0
  1. Avatar for pvc78 41. pvc78 Lv 1 46 pts. 8,793
  2. Avatar for Giant Berk 42. Giant Berk Lv 1 45 pts. 8,786
  3. Avatar for alcor29 43. alcor29 Lv 1 44 pts. 8,782
  4. Avatar for aznarog 44. aznarog Lv 1 44 pts. 8,780
  5. Avatar for goastano 45. goastano Lv 1 43 pts. 8,779
  6. Avatar for nemo7731 46. nemo7731 Lv 1 42 pts. 8,764
  7. Avatar for gurch 47. gurch Lv 1 41 pts. 8,763
  8. Avatar for reefyrob 48. reefyrob Lv 1 40 pts. 8,758
  9. Avatar for hpaege 49. hpaege Lv 1 39 pts. 8,758
  10. Avatar for shettler 50. shettler Lv 1 38 pts. 8,750

Comments