Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 9,155
  2. Avatar for MaartenDesnouck 2. MaartenDesnouck Lv 1 91 pts. 9,154
  3. Avatar for jamiexq 3. jamiexq Lv 1 81 pts. 9,150
  4. Avatar for lamoille 4. lamoille Lv 1 73 pts. 9,150
  5. Avatar for LociOiling 5. LociOiling Lv 1 65 pts. 9,140
  6. Avatar for reefyrob 6. reefyrob Lv 1 58 pts. 9,137
  7. Avatar for Deleted player 7. Deleted player pts. 9,137
  8. Avatar for smilingone 8. smilingone Lv 1 46 pts. 9,137
  9. Avatar for Deleted player 9. Deleted player 41 pts. 9,136
  10. Avatar for Bletchley Park 10. Bletchley Park Lv 1 36 pts. 9,133

Comments