Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since over 10 years ago

Intermediate Overall Prediction

Summary

Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 32 pts. 9,132
  2. Avatar for mimi 12. mimi Lv 1 28 pts. 9,117
  3. Avatar for gitwut 13. gitwut Lv 1 24 pts. 9,117
  4. Avatar for grogar7 14. grogar7 Lv 1 21 pts. 9,115
  5. Avatar for bertro 15. bertro Lv 1 18 pts. 9,113
  6. Avatar for Mike Cassidy 16. Mike Cassidy Lv 1 16 pts. 9,110
  7. Avatar for dembones 17. dembones Lv 1 14 pts. 9,109
  8. Avatar for brgreening 18. brgreening Lv 1 12 pts. 9,109
  9. Avatar for dflear 19. dflear Lv 1 10 pts. 9,095
  10. Avatar for jermainiac 20. jermainiac Lv 1 9 pts. 9,084

Comments