Placeholder image of a protein
Icon representing a puzzle

1111: Unsolved De-novo Freestyle 53

Closed since almost 11 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
July 07, 2015
Expires
Max points
100
Description

This protein is known to activate cysteine desulferase, an enzyme that converts cysteine to alanine by transferring a sulfur atom. The structure of this protein is still unsolved. The PSIPRED secondary structure predictions are provided on the starting model.



Sequence:

MPGFTAPTRRQVLSLYKEFIKNANQFNNYNFREYFLSKTRTTFRKNMNQQDPKVLMNLFKEAKNDLGVLKRQSVISQMYTFDRLVVEPLQGRKH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,155
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,140
  3. Avatar for Contenders 3. Contenders 63 pts. 9,133
  4. Avatar for Void Crushers 4. Void Crushers 49 pts. 9,112
  5. Avatar for Go Science 5. Go Science 37 pts. 9,075
  6. Avatar for Gargleblasters 6. Gargleblasters 28 pts. 9,032
  7. Avatar for Deleted group 7. Deleted group pts. 8,943
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 8,930
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 11 pts. 8,853
  10. Avatar for Deleted group 10. Deleted group pts. 8,709

  1. Avatar for Amphimixus 91. Amphimixus Lv 1 15 pts. 8,461
  2. Avatar for alwen 92. alwen Lv 1 14 pts. 8,437
  3. Avatar for Anfinsen_slept_here 93. Anfinsen_slept_here Lv 1 14 pts. 8,433
  4. Avatar for NameChangeNeeded01 94. NameChangeNeeded01 Lv 1 13 pts. 8,425
  5. Avatar for Iron pet 95. Iron pet Lv 1 13 pts. 8,423
  6. Avatar for eromana 96. eromana Lv 1 13 pts. 8,422
  7. Avatar for christioanchauvin 97. christioanchauvin Lv 1 12 pts. 8,417
  8. Avatar for ManVsYard 98. ManVsYard Lv 1 12 pts. 8,390
  9. Avatar for Soggy Doglog 99. Soggy Doglog Lv 1 12 pts. 8,388
  10. Avatar for Mr_Jolty 100. Mr_Jolty Lv 1 11 pts. 8,385

Comments